PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000950.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 847aa    MW: 94609.5 Da    PI: 9.4616
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000950.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB734.8e-231701786
                    NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                             m++++P  a+i+++aketvq+ v+efi +vt++a++++++e+rkt++++dl+wa+  lG+  yv +++++
  Itr_sc000950.1_g00003.1  1 MREAIPRSARIAEEAKETVQKWVTEFIHYVTAKANERAKQERRKTVTTEDLIWAMRALGLGSYVLEFDTW 70
                             899************************************************************9887766 PP

2NF-YB68.51.2e-217267882991
                    NF-YB  29 kdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                               +aketvq+cv+efi  vt++a++++++e+rkt++++dl+wa+  lG+  y+++l+++++ y 
  Itr_sc000950.1_g00003.1 726 SEAKETVQKCVTEFIHRVTAKANERAKQERRKTVTTEDLIWAMRALGLGSYAQELTAFIMDYC 788
                              68**********************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471137.14E-18165IPR009072Histone-fold
PfamPF008082.3E-15155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.106.0E-23166IPR009072Histone-fold
PfamPF142448.1E-13157203IPR029472Gag-polypeptide of LTR copia-type
PROSITE profilePS5099411.923253381IPR001584Integrase, catalytic core
SuperFamilySSF530981.18E-28253390IPR012337Ribonuclease H-like domain
Gene3DG3DSA:3.30.420.101.4E-16253374IPR012337Ribonuclease H-like domain
PfamPF006651.6E-10253332IPR001584Integrase, catalytic core
SuperFamilySSF471132.33E-17723787IPR009072Histone-fold
PfamPF008082.0E-13726768IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.107.5E-21726788IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0015074Biological ProcessDNA integration
GO:0003676Molecular Functionnucleic acid binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 847 aa     Download sequence    Send to blast
MREAIPRSAR IAEEAKETVQ KWVTEFIHYV TAKANERAKQ ERRKTVTTED LIWAMRALGL  60
GSYVLEFDTW QQEQLYLAFS LGAFSSPSMA AWPPISSRST PMDNSTGNPA GTGNPILGNA  120
RNQAGSGNPI TGSATSEPAA TEVTFNSQTH SNPYFLHINE SPALELVSFP LVGSNYHPWA  180
RAMSMSLSCK NKLVFVNGTI TKPSTDDLER YLAWERCNNM VVSWVVRTLS PSIGSTVLWI  240
DTAYGVWEDL KRSRAVWVYL MRTKSEVRSL IIQFCNLVKN QFGTTVKCIR SDNGLEFNLQ  300
DYFSQKGIIH QTSCTYTPQQ NSRVERKHGH LLSTARSLRF QANLPEQFWG ECVLHAAYII  360
NRLPSAAIDN HIPYQILIKR SPQYGHLRVF GCLAYASTVG PKSKLDARSK KCIFLGYTNG  420
TKGYKVYDLI TKELFVSRDV TFYEHVFPLQ QGNSSAVGNP QLIFPTMNND LLEVPKSPQF  480
QNQDNNRGEH TPLRNSSFEQ SRELHSPNQA SSSDEACPSL SEVPEQSGVI SSNSPLPLVT  540
RKSTRQKHPP NYLQDYVCQS TTRSMKTVSV LPLPSLFFLL LLRNTTPRNL LHAFITDYRA  600
THVHGRAASH PCRRCHRRQS SRYRLCRAFR FRGLLPNRCT TAPVVPPPPL PPPSAVTIFL  660
IPHTLPPTLT VEIPFPSMHA CNNVCRAILL VPLYIFISPS SSPNYTWEAK MNADDNAAAD  720
GPHWRSEAKE TVQKCVTEFI HRVTAKANER AKQERRKTVT TEDLIWAMRA LGLGSYAQEL  780
TAFIMDYCAK HVHGRAATHP LPPRAAARPA GTVYAGFSSA GGSASSSSPF GGDYFLDPSY  840
PPTNFDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B8e-171731991NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A8e-171731991NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.12e-18NF-YB family protein